PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00726
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 475aa    MW: 53792.1 Da    PI: 5.1384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00726genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.5e-142670348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT+eEd++l + + ++G+++W+ Ia+++   ++  qc+ rw++yl
       AA53G00726 26 TWTPEEDDILRKEISLHGTENWAIIASKFK-DKSTRQCRRRWYTYL 70
                     6****************************9.*************97 PP

2Myb_DNA-binding44.73e-1476119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg W++eEd ll +a +++G++ W+ Ia+ +  gRt++ +k+r+ +
       AA53G00726  76 RGGWSPEEDTLLCEAQRLFGNR-WTEIAKVVS-GRTDNAVKNRFTT 119
                      789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3111970IPR017930Myb domain
SMARTSM007171.8E-132372IPR001005SANT/Myb domain
SuperFamilySSF466892.02E-2523117IPR009057Homeodomain-like
CDDcd001677.65E-132670No hitNo description
Gene3DG3DSA:1.10.10.603.5E-202778IPR009057Homeodomain-like
PfamPF139211.9E-152787No hitNo description
PROSITE profilePS5129420.81271125IPR017930Myb domain
SMARTSM007178.4E-1575123IPR001005SANT/Myb domain
CDDcd001671.73E-1079120No hitNo description
Gene3DG3DSA:1.10.10.605.2E-1979124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MQETTKKKKK IVNNEDSKKK ERHIVTWTPE EDDILRKEIS LHGTENWAII ASKFKDKSTR  60
QCRRRWYTYL NSDFKRGGWS PEEDTLLCEA QRLFGNRWTE IAKVVSGRTD NAVKNRFTTL  120
CKKRAKYEAM AKENRIACCV NSNNKRMLFP DGISTPRKTE NEAPLAKKMR RSHIPDLTEI  180
SNYGDRSHLK VGSGVNQQIR PPFSVLVHNA TGVASKEEQN ETSNVKESDV DDKCNQGVFL  240
NKDDPKVTAL MQQAELLTSL AQKFNADNTE QSMENAWKVL QDFLNKSKEN DLFRYGIPEF  300
DFQLEEFKDL VEDLRCSNED SQASWRQPDL HDSPASSEYS SGSTSMPNPS ADQTQQPLSD  360
TQTTTQEQEQ EPEELLQGIV SDATTTVDQV DLVSTCDVLK NHDEIVAMSV EEEFSSPLQV  420
TPLFRSLAAG IPSPQFSESE RNFLLKTLGV ESPCPCPSAN PSQPPPCKRV LLDSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-252712510108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395755.10.0hypothetical protein EUTSA_v10004109mg
TrEMBLV4MNC30.0V4MNC3_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.5__181__AT2G02820.20.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.20.0myb domain protein 88